FOXO4 10mg x 10 Vials
$230.00
FOXO4 10 mg x 10 Vials—FOXO4-DRI (FOXO4 D-Retro-Inverso) is a synthetic peptide engineered in a D-retro-inverso configuration based on a defined peptide sequence. The retro-inverso design and D-residue composition are utilized in research to examine peptide stability and interaction characteristics in vitro. Supplied as a lyophilized powder, FOXO4-DRI is intended strictly for controlled laboratory research.
Description
FOXO4 10mg Research Peptide
FOXO4 research peptide material is used in controlled laboratory workflows involving molecular characterization, stability assessment, and biochemical pathway research. Exact identity and batch-linked analytical records are important when comparing FOXO4 materials. buy FOXO4-DRI
The ten-vial configuration supports organized inventory, repeat analytical runs, and multi-sample research while allowing individual vials to remain associated with the relevant lot and analytical documentation.
Product Name:
FOXO4-DRI (FOXO4 D-Retro-Inverso)
Chemical Information:
- Molecular Formula: C228H388N86O64
- Molecular Weight: ~5358 g/mol
- Sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino acids; retro-inverso)
- Structure Class: Synthetic peptide (D-retro-inverso configuration)
Molecular Structure:

Specifications and Chemical Profile
Product: FOXO4 10mg
Content Per Vial: 10 mg
Pack Size: 10 vials
Total Labeled Material: 100 mg across the pack
Format: lyophilized research peptide
Research Setting: qualified laboratory and analytical research only
Strength and pack quantity are procurement specifications. Laboratories should confirm the material received against the label and lot-specific documentation before analytical work begins.
Purity, HPLC, Mass Spectrometry, and COA
qualification should be supported by analytical documentation linked to the supplied batch. HPLC can support chromatographic purity assessment, while mass spectrometry can provide complementary molecular-identity information. A batch-specific Certificate of Analysis helps connect procurement records to the exact material used in laboratory studies.
Identity, purity, labeled content, and lot number should be evaluated as separate quality attributes. Laboratories should retain the applicable documentation with experimental records and avoid relying on a purity percentage alone when qualifying research material.
High Purity FOXO4 10mg Searches
Researchers searching for FOXO4 research peptide, high-purity FOXO4 peptide, and FOXO4 peptide USA may be comparing research suppliers, vial strengths, and analytical standards. High Purity Peptides currently lists this exact strength as a ten-vial product and emphasizes research-only positioning. Puri Peptides offers its own independently branded research format.
Products from separate suppliers should not be assumed to be identical. Buyers should compare exact identity, per-vial content, analytical methods, lot documentation, and packaging and storage information before procurement.
Laboratory Research Applications
Qualified studies may include peptide identity and characterization, analytical-method development, stability and degradation profiling, controlled biochemical assays, and comparative research involving related peptide systems. Experimental design should identify the exact material, lot, sample preparation, and analytical conditions used.
Reproducibility depends on careful documentation. Lot identity, storage history, assay parameters, and instrumentation should remain consistent or be recorded whenever they change between research runs.
FOXO4 10 mg x 10 vials USA
Searches including FOXO4 10mg for sale, buy FOXO4 10mg online, and FOXO4 10mg x 10 vials commonly indicate that a laboratory buyer wants an exact strength and pack configuration. Puri Peptides identifies both directly: 10 mg per vial and ten research vials per pack.
This listing does not provide personal-use preparation, reconstitution, dosage, or administration instructions.
FOXO4 10mg x 10 Vials for Sale in Tennessee
Buy FOXO4-Dri 10mg peptide vials, supplied by Puri Peptides as ten individually identifiable lyophilized research vials. Each vial contains 10 mg of labeled research material, providing 100 mg across the complete pack.
This product is intended strictly for qualified laboratory and analytical investigation. The milligram designation identifies research material content only and is not a human or animal dosage.
FOXO4 10mg Research Supply in Tennessee
Qualified laboratory customers seeking to Buy FOXO4-Dri 10mg peptide vials in Tennessee can review this ten-vial format through Puri Peptides, subject to current inventory and shipping eligibility. Procurement decisions should consider material identity, analytical documentation, batch traceability, and exact pack configuration.
Wholesale FOXO4 10mg Research Supply
Laboratories and analytical organizations requiring multiple ten-vial packs can inquire about larger-volume availability. Consistent lot sourcing can simplify documentation for repeated analytical work and reduce unnecessary material variation across research runs.
Before larger procurement, buyers should confirm the required pack count, current lot availability, and corresponding analytical documentation.
Storage and Handling
Keep lyophilized research vials sealed, dry, and protected from direct light, excessive heat, moisture, and contamination. Follow storage information associated with the actual product and batch documentation and maintain clear vial and lot identification throughout laboratory storage.
FAQ
How many vials are included with FOXO4 10 mg?
Each pack contains 10 research vials, with 10 mg of labeled research material per vial.
Where can I buy FOXO4-Dri 10mg peptide vials ?
Qualified U.S. research customers can review this ten-vial research pack through Puri Peptides, subject to inventory and shipping eligibility.
Can I buy FOXO4 10mg in Tennessee?
Puri Peptides provides online ordering for qualified research customers in Tennessee, subject to availability and applicable shipping requirements.
What should I compare before choosing a supplier?
Compare exact research-material identity, per-vial strength, pack size, analytical testing, batch-specific documentation, storage information, and clearly stated research-use restrictions.
Compliance
FOR RESEARCH USE ONLY – NOT FOR HUMAN OR ANIMAL USE. This material is supplied solely for laboratory research and analytical purposes. It is not intended for therapeutic, diagnostic, dietary, veterinary, or clinical application.














