Compare“THYMALIN 10mg x 10 Vials” has been added to the compare list

PNC27 10mg 10ml x 10 Vials

Name: PNC27 10mg 10ml x 10 Vials
Brand: Puri Peptides
SKU: 7615
Price: 140.00 USD
Availability: InStock

$140.00

PNC27 10mg 10ml x 10 Vials — ten-vial research pack. PNC-27 is a synthetic peptide consisting of a defined amino acid sequence. It is supplied in lyophilized powder form to support purity and stability in laboratory environments. PNC-27 is intended strictly for controlled in vitro laboratory research by qualified professionals.

Ask a question Delivery & Return

Research Use Only: Puri Peptides products are supplied exclusively for laboratory, analytical, and scientific research purposes. They are not intended for human or animal consumption, administration, or use.

Intended Purpose: Products offered by Puri Peptides are intended for controlled laboratory research, analytical evaluation, method development, and other legitimate scientific research applications. They are not intended for diagnostic, therapeutic, clinical, cosmetic, or veterinary use.

FDA Disclosure: Statements made on this website and products offered by Puri Peptides have not been evaluated by the U.S. Food and Drug Administration (FDA). These products are not intended to diagnose, treat, cure, mitigate, or prevent any disease or medical condition.

Researcher Responsibility: By purchasing from Puri Peptides, the purchaser acknowledges that products are being obtained for research purposes only and accepts responsibility for their appropriate handling, storage, use, and compliance with applicable laws and institutional requirements.

Description

PNC27 10mg 10ml Research Material

PNC27 is a synthetic research peptide used in qualified laboratory studies involving peptide identity, analytical characterization, stability, and controlled biochemical models. This presentation identifies both 10 mg labeled peptide content and a 10 ml vial format for clear procurement records. Buy the PNC-27 peptide online. The ten-vial configuration supports organized inventory, repeat analytical runs, and multi-sample workflows while allowing individual containers to remain associated with the relevant lot and analytical documentation.

Product Name:

PNC-27

Chemical Information:

Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight: 4031.7 g/mol
Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Structure Class: Energy minimized structure of PNC-27

Molecular Structure:

Specifications and Chemical Profile

Product: PNC-27 10mg 10ml
Labeled Peptide Content Per Vial: 10 mg
Vial Volume: 10 ml
Pack Size: 10 vials
Total Labeled Peptide: 100 mg across the pack
Format: research peptide vial
Research Setting: qualified laboratory and analytical research only

Strength, vial format, and pack quantity are procurement specifications. Laboratories should confirm material received against its label and corresponding lot documentation before analytical work begins.

Purity, HPLC, Mass Spectrometry, and COA

Research peptide qualification should be supported by analytical documentation linked to the supplied batch. HPLC can support chromatographic purity assessment, while mass spectrometry can provide complementary molecular-identity information. A lot-specific Certificate of Analysis improves traceability between procurement records and experimental use.

Identity, purity, labeled content, and lot number should be evaluated separately. Laboratories should retain applicable documentation with experimental records and avoid relying on a single purity figure as the only measure of research-material quality.

High Purity PNC-27 10mg 10ml Searches

Researchers searching for PNC27 10mg 10ml for sale, buy PNC-27 10mg online, and PNC27 research peptide and related terms may be comparing research suppliers, strengths, and analytical standards. High Purity Peptides currently lists this exact format as a ten-vial product. Puri Peptides offers its own independently branded research material.

Products from separate suppliers should not be assumed to be identical. Buyers should compare exact identity, per-vial content, vial volume where applicable, analytical methods, lot documentation, and packaging and storage information.

Laboratory Research Applications

Qualified studies may include peptide identity and characterization, analytical-method development, stability and degradation profiling, controlled biochemical assays, and comparative research involving related peptide systems. Experimental design should identify the exact material, lot, sample preparation, and analytical conditions used.

Reproducibility depends on careful documentation. Lot identity, storage history, assay parameters, and instrumentation should remain consistent or be recorded whenever they change between research runs.

Buy PNC27 10 mg 10 ml x 10 vials in New Jersey.

PNC27 10mg 10ml x 10 vials is supplied by Puri Peptides as a ten-vial research pack for qualified laboratory and analytical investigation. The complete vial format is stated directly in the product title, while the URL remains focused on the product and strength.

This material is intended strictly for laboratory research. Milligram values and vial volume are product specifications and are not human or animal dosage or administration instructions.

PNC27 10mg 10ml x 10 Vials USA

Searches including PNC27 10 mg 10 ml x 10 vials, high-purity PNC27 10 mg, and PNC27 peptide USA commonly indicate that a laboratory buyer wants a specific strength and pack configuration. Puri Peptides identifies the ten-vial configuration directly in the title and specifications.

This listing does not provide personal-use preparation, reconstitution, dosage, injection, or administration instructions.

PNC27 10mg 10ml Research Supply in New Jersey

Qualified laboratory customers seeking PNC27 10 mg 10 ml in New Jersey can review this ten-vial format through Puri Peptides, subject to current inventory and shipping eligibility. Procurement decisions should consider exact identity, documentation, batch traceability, and pack configuration.

Wholesale PNC27 10 mg 10 ml Research Supply

Laboratories and analytical organizations requiring multiple ten-vial packs can inquire about larger-volume availability. Consistent lot sourcing can simplify documentation for repeated analytical work and reduce unnecessary material variation across research runs.

Before larger procurement, buyers should confirm the required pack count, current lot availability, exact vial format, and corresponding analytical documentation.

Storage and Handling

Keep research vials sealed, dry, and protected from contamination, direct light, excessive heat, and unsuitable environmental conditions. Follow storage information associated with the actual product and batch documentation and maintain clear vial and lot identification.

FAQ

How many vials are included with PNC27 10 mg 10 ml?

Each pack contains 10 research vials in the format stated in the product specifications.

Where can I buy PNC27 10 mg 10 ml x 10 vials?

Qualified U.S. research customers can review this ten-vial research pack through Puri Peptides, subject to inventory and shipping eligibility.

Can I buy PNC27 10 mg 10 ml in New Jersey?

Puri Peptides provides online ordering for qualified research customers in New Jersey, subject to availability and applicable shipping requirements.

What should I compare before choosing a supplier?

Compare exact research-material identity, labeled quantity, vial format, pack size, analytical documentation, batch traceability, storage information, and research-use restrictions.

Compliance

FOR RESEARCH USE ONLY – NOT FOR HUMAN OR ANIMAL USE. This material is supplied solely for laboratory research and analytical purposes. It is not intended for therapeutic, diagnostic, dietary, veterinary, or clinical application.