PNC27 5mg 5ml x 10 Vials
$90.00
PNC27 5mg 5ml x 10 Vials — ten-vial research pack. PNC-27 is a synthetic peptide consisting of a defined amino acid sequence. It is supplied in lyophilized powder form to support purity and stability in laboratory environments. PNC-27 is intended strictly for controlled in vitro laboratory research by qualified professionals.
Description
PNC-27 5mg Research Peptide
PNC-27 5mg is a synthetic research peptide supplied for qualified laboratory and analytical research. The product is presented as a research material for laboratories conducting controlled investigations involving peptide identity, characterization, stability, and biochemical research. Buy PNC-27 peptide vial. Each package contains 10 individual vials, with 5mg of labeled PNC-27 per vial. The defined package format supports organized laboratory inventory, repeat analytical workflows, and clear documentation of individual research materials.
Product Name:
PNC-27
Chemical Information:
- Molecular Formula: C188H293N53O44S
- Molecular Weight: 4031.7 g/mol
- Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- Structure Class: Energy minimized structure of PNC-27
Molecular Structure:

This product is intended exclusively for laboratory research. Product quantity and packaging specifications should not be interpreted as recommendations for dosing, administration, or therapeutic use.
PNC-27 5mg Specifications
- Product: PNC-27 Research Peptide
- Labeled content: 5mg per vial
- Pack size: 10 vials
- Total labeled material: 50mg per package
- Research setting: Qualified laboratory and analytical research
- Intended use: Research use only
Researchers should verify the material received against the product label, lot information, and accompanying documentation before beginning analytical work.
Analytical Documentation and COA
Appropriate documentation is an important part of research-material procurement. Depending on the supplied batch and testing performed, documentation may include peptide identity information, purity analysis, composition data, analytical results, and a Certificate of Analysis (COA).
Research teams should retain relevant documentation with their laboratory records. Maintaining the lot number, product specifications, analytical documentation, and storage information helps establish traceability between the purchased material and subsequent research activities.
When comparing PNC-27 products from different suppliers, researchers should avoid assuming that products with similar names or labeled quantities are identical. Exact material identity, specifications, documentation, and lot information should be independently reviewed.
PNC-27 5mg Research Applications
PNC-27 may be examined in qualified laboratory research involving peptide characterization, analytical-method development, controlled biochemical models, stability investigations, and comparative peptide studies.
Research protocols should clearly identify the material being evaluated and document relevant experimental parameters. Depending on the study design, this may include the material’s lot number, analytical method, sample preparation, environmental conditions, instrumentation, and testing parameters.
Consistent documentation can help researchers compare results between different analytical runs and maintain reproducibility across research projects.
PNC-27 5mg x 10 Vials
The PNC-27 5mg x 10 vials configuration provides ten individually packaged research vials. This format can be useful for laboratories that require multiple containers for organized inventory management or repeated analytical projects.
The labeled quantity is 5mg per vial, with a package containing ten vials. Researchers should review the actual product label and batch documentation upon receipt to confirm the supplied configuration.
Availability and shipping eligibility may vary depending on location, applicable regulations, and supplier requirements.
Wholesale PNC-27 Research Supply
Laboratories, research organizations, and analytical groups requiring multiple packages may inquire about wholesale or larger-volume availability.
For recurring research projects, maintaining consistent sourcing and careful lot documentation can simplify inventory management and help researchers track material differences between research batches.
Before purchasing larger quantities, buyers should confirm the exact product name, labeled quantity, number of vials, current lot availability, analytical documentation, and applicable storage requirements.
Storage and Handling
Research materials should be handled according to the storage and handling information supplied with the specific product and batch. Keep containers appropriately sealed and protected from contamination, direct light, and unsuitable environmental conditions.
Laboratories should maintain clear product and lot identification throughout storage and handling. Any relevant storage conditions or handling observations should be recorded as part of the laboratory’s research documentation.
Frequently Asked Questions
How much PNC-27 is in each vial?
Each vial is labeled as containing 5mg of PNC-27.
How many vials are included?
The standard package contains 10 research vials.
What is the total labeled quantity?
A 10-vial package containing 5mg per vial represents 50mg of labeled material in total.
Where can I buy PNC-27 5mg?
Qualified research customers can review PNC-27 research-material suppliers and compare product specifications, documentation, lot information, and purchasing requirements.
What should I compare before purchasing PNC-27?
Compare the exact peptide identity, labeled quantity, package size, analytical documentation, lot traceability, storage information, and stated research-use restrictions.
Is PNC-27No. This product is presented strictly as a for human use?
No. This product is presented strictly as a research material and is not intended for human or animal administration.
Compliance
FOR RESEARCH USE ONLY — NOT FOR HUMAN OR ANIMAL USE.
This material is supplied solely for laboratory research and analytical purposes. It is not intended for therapeutic, diagnostic, dietary, veterinary, or clinical application. Product specifications describe the supplied research material and should not be interpreted as instructions for human or animal use.














